{"product_id":"proteintech-28549-1-ap","title":"Proteintech, 28549-1-AP, Alpha 2-Antiplasmin Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Alpha 2-Antiplasmin (28549-1-AP) by Proteintech is a Polyclonal antibody targeting Alpha 2-Antiplasmin in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n28549-1-AP targets Alpha 2-Antiplasmin in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, THP-1 cells,  mouse liver tissue,  rat liver tissue\nPositive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSERPINF2, also termed Alpha-2-antiplasmin(a2-AP), a member of the serpin family of serine protease inhibitors. SERPINF2 is a major inhibitor of plasmin, which degrades fibrin and various other proteins. Consequently, the proper function of this gene has a major role in regulating the blood clotting pathway. Mutations in SERPINF2 result in alpha-2-plasmin inhibitor deficiency, which is characterized by severe hemorrhagic diathesis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag29670 Product name: Recombinant human SERPINF2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 348-491 aa of BC031592 Sequence: VATLSQLGLQELFQAPDLRGISEQSLVVSGVQHQSTLELSEVGVEAAAATSIAMSRMSLSSFSVNRPFLFFIFEDTTGLPLFVGSVRNPNPSAPRELKEQQDSPGNKDFLQSLKGFPRGDKLFGPDLKLVPPMEEDYPQFGSPK Predict reactive species\nFull Name: serpin peptidase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 2\nCalculated Molecular Weight: 491 aa, 55 kDa\nObserved Molecular Weight: 55 kDa\nGenBank Accession Number: BC031592\nGene Symbol: Alpha-2-antiplasmin\nGene ID (NCBI): 5345\nRRID: AB_2918174\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P08697\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869807497385,"sku":"28549-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-28549-1-ap","provider":"Iright","version":"1.0","type":"link"}