{"product_id":"proteintech-28566-1-ap","title":"Proteintech, 28566-1-AP, MATN1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MATN1 (28566-1-AP) by Proteintech is a Polyclonal antibody targeting MATN1 in WB, IF\/ICC, ELISA applications with reactivity to pig, human samples\n28566-1-AP targets MATN1 in WB, IF\/ICC, ELISA applications and shows reactivity with pig, human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: pig cartilage tissue\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMATN1 (matrilin 1), also known as CMP. It is expected to be located in extracellular space, the protein is mainly expressed in cartilage tissue and retina tissue. Also, the protein is a member of von Willebrand factor A domain containing protein family. This family of proteins are thought to be involved in the formation of filamentous networks in the extracellular matrices of various tissues. Mutations of this gene have been associated with variety of inherited chondrodysplasias. It is reproted that COMP and matrilin-1 elute together in the gel filtration of cartilage extracts and can be co-immunoprecipitated with the presence of calcium (PMID: 15075323). The calculated molecular weight of MATN1 is 54 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: pig, human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag29386 Product name: Recombinant human MATN1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 160-280 aa of NM_002379 Sequence: SVQDVSARARASGVELFAIGVGSVDKATLRQIASEPQDEHVDYVESYSVIEKLSRKFQEAFCVVSDLCATGDHDCEQVCISSPGSYTCACHEGFTLNSDGKTCNVCSGGGGSSATDLVFLI Predict reactive species\nFull Name: matrilin 1, cartilage matrix protein\nCalculated Molecular Weight: 54 kDa\nObserved Molecular Weight: 54 kDa\nGenBank Accession Number: NM_002379\nGene Symbol: MATN1\nGene ID (NCBI): 4146\nRRID: AB_3669662\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P21941\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887714128041,"sku":"28566-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-28566-1-ap","provider":"Iright","version":"1.0","type":"link"}