{"product_id":"proteintech-28591-1-ap","title":"Proteintech, 28591-1-AP, APOL3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe APOL3 (28591-1-AP) by Proteintech is a Polyclonal antibody targeting APOL3 in WB, ELISA applications with reactivity to Human samples\n28591-1-AP targets APOL3 in WB, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, BxPC-3 cells,  HCT 116 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nApolipoprotein L3(APOL3) is a member of the apolipoprotein L gene family, and it is present in a cluster with other family members on chromosome 22. APOL3 is localized in the cytoplasm and plays a central role in cholesterol transport, affecting the movement of lipids, including cholesterol, and allowing the binding of lipids to organelles.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag29687 Product name: Recombinant human APOL3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 246-380 aa of NM_145640 Sequence: SSAEAEASRLTATSIDRLKVFKEVMRDITPNLLSLLNNYYEATQTIGSEIRAIRQARARARLPVTTWRISAGSGGQAERTIAGTTRAVSRGARILSATTSGIFLALDVVNLVYESKHLHEGAKSASAEELRRQAQ Predict reactive species\nFull Name: apolipoprotein L, 3\nCalculated Molecular Weight: 44 kDa\nObserved Molecular Weight: 44 kDa\nGenBank Accession Number: NM_145640\nGene Symbol: APOL3\nGene ID (NCBI): 80833\nRRID: AB_3669663\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O95236\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46884996743337,"sku":"28591-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-28591-1-ap","provider":"Iright","version":"1.0","type":"link"}