{"product_id":"proteintech-28594-1-ap","title":"Proteintech, 28594-1-AP, Siglec-15 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Siglec-15 (28594-1-AP) by Proteintech is a Polyclonal antibody targeting Siglec-15 in WB, ELISA applications with reactivity to Human samples\n28594-1-AP targets Siglec-15 in WB, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, NCI-H1299 cells,  PC-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSialic acid binding Ig-like lectin 15 (Siglec-15) is a member of the Siglec family of glycan-recognition proteins. Siglec-15 is a type-I transmembrane protein consisting of two immunoglobulin (Ig)-like domains, a transmembrane domain, and a short cytoplasmic tail (PMID: 17483134). It is mainly expressed on a subset of myeloid lineage cells and can be upregulated in many cancers (PMID: 32939323). Siglec-15 has been reported as a immune suppressor and a potential target for normalization cancer immunotherapy (PMID: 30833750). Siglec-15 has a calculated molecular weight of 36 kDa. It has been detected at 38-40 kDa due to glycosylation (PMID: 32921411).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nCited Reactivity: human, mouse, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag29829 Product name: Recombinant human SIGLEC15 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 20-160 aa of NM_213602 Sequence: FVRTKIDTTENLLNTEVHSSPAQRWSMQVPPEVSAEAGDAAVLPCTFTHPHRHYDGPLTAIWRAGEPYAGPQVFRCAAARGSELCQTALSLHGRFRLLGNPRRNDLSLRVERLALADDRRYFCRVEFAGDVHDRYESRHGV Predict reactive species\nFull Name: sialic acid binding Ig-like lectin 15\nCalculated Molecular Weight: 36 kDa\nObserved Molecular Weight: 38-40 kDa\nGenBank Accession Number: NM_213602\nGene Symbol: Siglec-15\nGene ID (NCBI): 284266\nRRID: AB_2918178\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6ZMC9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869763981481,"sku":"28594-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-28594-1-ap","provider":"Iright","version":"1.0","type":"link"}