{"product_id":"proteintech-28625-1-ap","title":"Proteintech, 28625-1-AP, SARM1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SARM1 (28625-1-AP) by Proteintech is a Polyclonal antibody targeting SARM1 in WB, IHC, IF\/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples\n28625-1-AP targets SARM1 in WB, IHC, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Daudi cells, HEK-293 cells,  Neuro-2a cells,  Raji cells,  human testis tissue,  SH-SY5Y cells,  mouse brain tissue,  rat brain tissue\nPositive IHC detected in: rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: SH-SY5Y cells\nPositive FC (Intra) detected in: SH-SY5Y cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSARM1 (sterile alpha and Toll\/interleukin-1 receptor motif-containing 1) is also named as KIAA0524, SAMD2 and SARM. SARM1 is the major pro-degenerative protein in axons (PMID: 32152523). SARM1 is the central executioner of pathological axon degeneration and is an inducible NAD+-cleavage enzyme that is activated by the loss of the NAD+ biosynthetic enzyme NMNAT2 (PMID: 33657413). SARM1 is involved in innate immune response: inhibits both TICAM1\/TRIF- and MYD88-dependent activation of JUN\/AP-1, TRIF-dependent activation of NF-kappa-B and IRF3, and the phosphorylation of MAPK14\/p38 (PMID: 16964262).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag29531 Product name: Recombinant human SARM1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 352-573 aa of NM_015077 Sequence: EAAIKSLQGKTKVFSDIGAIQSLKRLVSYSTNGTKSALAKRALRLLGEEVPRPILPSVPSWKEAEVQTWLQQIGFSKYCESFREQQVDGDLLLRLTEEELQTDLGMKSGITRKRFFRELTELKTFANYSTCDRSNLADWLGSLDPRFRQYTYGLVSCGLDRSLLHRVSEQQLLEDCGIHLGVHRARILTAAREMLHSPLPCTGGKPSGDTPDVFISYRRNSG Predict reactive species\nFull Name: sterile alpha and TIR motif containing 1\nCalculated Molecular Weight: 79 kDa\nObserved Molecular Weight: 70-80 kDa\nGenBank Accession Number: NM_015077\nGene Symbol: SARM1\nGene ID (NCBI): 23098\nRRID: AB_3086070\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6SZW1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869760180393,"sku":"28625-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-28625-1-ap","provider":"Iright","version":"1.0","type":"link"}