{"product_id":"proteintech-28627-1-ap","title":"Proteintech, 28627-1-AP, CLEC12A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CLEC12A (28627-1-AP) by Proteintech is a Polyclonal antibody targeting CLEC12A in WB, IF\/ICC, ELISA applications with reactivity to Human samples\n28627-1-AP targets CLEC12A in WB, IF\/ICC, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: U-937 cells, human peripheral blood leukocyte\nPositive IF\/ICC detected in: U-937 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCLEC12A, also known as CD371, MICL, DCAL-2 or CLL-1, is a type II transmembrane glycoprotein and a member of the C-type lectin superfamily (PMID: 30401586). This protein, which contains a single C-type lectin-like domain and a cytoplasmic immunoreceptor tyrosine-based inhibitory motif (ITIM), is related to LOX-1 and Dectin-1 and is variably spliced and highly N-glycosylated (PMID: 14739280). Its ITIM sequence recruits the tyrosine phosphatases SHP-1 and SHP-2 to negatively regulate Syk signaling. In humans, CLEC12A is mainly expressed on myeloid cells, being found on monocytes, granulocytes, macrophages and DC subsets, and at lower levels on CD4+ T cells (PMID: 32477350). The observed molecular weight of CLEC12A is between 40 and 75 kDa, which is much higher than the predicted molecular weight due to glycosylation (PMID: 14739280).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag27864 Product name: Recombinant human CLEC12A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-213 aa of BC063424 Sequence: MSEEVTYADLQFQNSSEMEKIPEIGKFGEKAPPAPSHVWRPAALFLTLLCLLLLIGLGVLASMFHVTLKIEMKKMNKLQNISEELQRNISLQLMSNMNISNKIRNLSTTLQTIATKLCRELYSKEQEHKCKPCPRRWIWHKDSCYFLSDDVQTWQESKMACAAQNASLLKINNKNALEFIKSQSRSYDYWLGLSPEEDSTRGMRVDNIINSSA Predict reactive species\nFull Name: C-type lectin domain family 12, member A\nCalculated Molecular Weight: 31 kDa\nObserved Molecular Weight: 55-75 kDa\nGenBank Accession Number: BC063424\nGene Symbol: CLEC12A\nGene ID (NCBI): 160364\nRRID: AB_3086071\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q5QGZ9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886596378793,"sku":"28627-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-28627-1-ap","provider":"Iright","version":"1.0","type":"link"}