{"product_id":"proteintech-28637-1-ap","title":"Proteintech, 28637-1-AP, ORAI1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ORAI1 (28637-1-AP) by Proteintech is a Polyclonal antibody targeting ORAI1 in WB, ELISA applications with reactivity to Human samples\n28637-1-AP targets ORAI1 in WB, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, A375 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nStore-operated calcium channels (SOCs) play essential functions in various physiological processes. ORAI1 is a complex glycosylated protein, it exists in several molecular weight forms: a theoretical molecular weight of 32.7 kDa of the unmodified protein and two major glycosylated proteins of ~43 kDa and ~50 kDa (PMID: 22318387). Human patients with a severe combinaed immunodeficiency (SCID) syndrome possess point mutations in Orai1 gene.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag29779 Product name: Recombinant human ORAI1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-75 aa of BC015369 Sequence: MHPEPAPPPSRSSPELPPSGGSTTSGSRRSRRRSGDGEPPGAPPPPPSAVTYPDWIGQSYSEVMSLNEHSMQALS Predict reactive species\nFull Name: ORAI calcium release-activated calcium modulator 1\nCalculated Molecular Weight: 301 aa, 33 kDa\nObserved Molecular Weight: 32 kDa, 45-50 kDa\nGenBank Accession Number: BC015369\nGene Symbol: ORAI1\nGene ID (NCBI): 84876\nRRID: AB_2881185\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96D31\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887746633897,"sku":"28637-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-28637-1-ap","provider":"Iright","version":"1.0","type":"link"}