{"product_id":"proteintech-28667-1-ap","title":"Proteintech, 28667-1-AP, Synaptotagmin-3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Synaptotagmin-3 (28667-1-AP) by Proteintech is a Polyclonal antibody targeting Synaptotagmin-3 in WB, IHC, IF-P, ELISA applications with reactivity to Human,  mouse,  rat samples\n28667-1-AP targets Synaptotagmin-3 in WB, IHC, IF-P, ELISA applications and shows reactivity with Human,  mouse,  rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe synaptotagmins are integral membrane proteins of synaptic vesicles thought to serve as Ca(2+) sensors in the process of vesicular trafficking and exocytosis (PMID: 8058779). Synaptotagmin-3 (SYT3) is highly expressed in brain, adipose tissue, and heart (PMID: 30545844). Synaptotagmin-3 is highly enriched in synaptic plasma membranes (PMID: 10373432). It has been reported that synaptotagmin-3 internalizes AMPA receptors to depress synaptic strength and promote forgetting (PMID: 30545844).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30027 Product name: Recombinant human SYT3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 85-330 aa of BC028379 Sequence: DKGGSAVGGGPLRKDLGPGVGLAGLVGGGGHHLAAGLGGHPLLGGPHHHAHAAHHPPFAELLEPGSLGGSDTPEPSYLDMDSYPEAAAAAVAAGVKPSQTSPELPSEGGAGSGLLLLPPSGGGLPSAQSHQQVTSLAPTTRYPALPRPLTQQTLTSQPDPSSEERPPALPLPLPGGEEKAKLIGQIKPELYQGTGPGGRRSGGGPGSGEAGTGAPCGRISFALRYLYGSDQLVVRILQAMDLPAKD Predict reactive species\nFull Name: synaptotagmin III\nCalculated Molecular Weight: 590 aa, 63 kDa\nObserved Molecular Weight: 70-75 kDa\nGenBank Accession Number: BC028379\nGene Symbol: Synaptotagmin-3\nGene ID (NCBI): 84258\nRRID: AB_2918187\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BQG1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887820624041,"sku":"28667-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-28667-1-ap","provider":"Iright","version":"1.0","type":"link"}