{"product_id":"proteintech-28678-1-ap","title":"Proteintech, 28678-1-AP, SCD1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SCD1 (28678-1-AP) by Proteintech is a Polyclonal antibody targeting SCD1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n28678-1-AP targets SCD1 in WB, IHC, IF\/ICC, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, A375 cells,  A549 cells,  HepG2 cells\nPositive IHC detected in: mouse liver tissue, human liver tissue,  mouse brown adipose tissue,  human colon cancer tissue,  human ovary tumor tissue,  human stomach cancer tissue,  rat heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSCD1 (stearoyl-CoA desaturase) is a microsomal fatty acid monodesaturase, which catalyses the committed step in the biosynthesis of mono-unsaturated fatty acids from saturated fatty acids (PMID:10946019). SCD1 and SCD2 are the main isoforms expressed in mouse liver and brain respectively (PMID:15907797). The formation of homodimers and oligomers is an intrinsic property of SCD proteins. SCD1 is a multi-pass membrane protein and detected double bands of 37-42 kDa. The degradation product of 28 kDa may be caused by a major cleavage site at the C-terminus (PMID:15610069, PMID: 9843580).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, monkey, goat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag29156 Product name: Recombinant human SCD protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-72 aa of BC005807 Sequence: MPAHLLQDDISSSYTTTTTITAPPSRVLQNGGDKLETMPLYLEDDIRPDIKDDIYDPTYKDKEGPSPKVEYV Predict reactive species\nFull Name: stearoyl-CoA desaturase (delta-9-desaturase)\nCalculated Molecular Weight: 355 aa, 41 kDa\nObserved Molecular Weight: 28-42 kDa\nGenBank Accession Number: BC005807\nGene Symbol: SCD\nGene ID (NCBI): 6319\nRRID: AB_2923581\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O00767\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868840349865,"sku":"28678-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-28678-1-ap","provider":"Iright","version":"1.0","type":"link"}