{"product_id":"proteintech-28738-1-ap","title":"Proteintech, 28738-1-AP, ALG13 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ALG13 (28738-1-AP) by Proteintech is a Polyclonal antibody targeting ALG13 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse samples\n28738-1-AP targets ALG13 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30299 Product name: Recombinant human ALG13 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 45-127 aa of BC005336 Sequence: TVVPEPFSTESFTLDVYRYKDSLKEDIQKADLVISHAGAGSCLETLEKGKPLVVVINEKLMNNHQLELAKQLHKEGHLFYCTC Predict reactive species\nFull Name: asparagine-linked glycosylation 13 homolog\nCalculated Molecular Weight: 1137 aa, 126 kDa\nObserved Molecular Weight: 130-135 kDa, 18 kDa\nGenBank Accession Number: BC005336\nGene Symbol: ALG13\nGene ID (NCBI): 79868\nRRID: AB_2918198\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NP73\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869634121897,"sku":"28738-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-28738-1-ap","provider":"Iright","version":"1.0","type":"link"}