{"product_id":"proteintech-28763-1-ap","title":"Proteintech, 28763-1-AP, HRH1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HRH1 (28763-1-AP) by Proteintech is a Polyclonal antibody targeting HRH1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n28763-1-AP targets HRH1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse heart tissue, rat heart tissue\nPositive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30464 Product name: Recombinant human HRH1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 305-416 aa of BC060802 Sequence: LDIEHMQAAAEGSSRDYVAVNRSHGQLKTDEQGLNTHGASEISEDQMLGDSQSFSRTDSDTTTETAPGKGKLRSGSNTGLDYIKFTWKRLRSHSRQYVSGLHMNRERKAAKQ Predict reactive species\nFull Name: histamine receptor H1\nCalculated Molecular Weight: 487 aa, 56 kDa\nObserved Molecular Weight: 56 kDa\nGenBank Accession Number: BC060802\nGene Symbol: HRH1\nGene ID (NCBI): 3269\nRRID: AB_3086085\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P35367\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887671300265,"sku":"28763-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-28763-1-ap","provider":"Iright","version":"1.0","type":"link"}