{"product_id":"proteintech-28819-1-ap","title":"Proteintech, 28819-1-AP, MEF2A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MEF2A (28819-1-AP) by Proteintech is a Polyclonal antibody targeting MEF2A in WB, IHC, ELISA applications with reactivity to Human, mouse, rat samples\n28819-1-AP targets MEF2A in WB, IHC, IF, ELISA applications and shows reactivity with Human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HUVEC cells, SH-SY5Y cells,  THP-1 cells\nPositive IHC detected in: rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMEF2A belongs to a family of DNA binding regulatory proteins. Each of these proteins which belong to the myocyte-specific enhancer factor-2 (MEF2) family binds to the MEF2 target DNA sequence present in the regulatory regions of many, if not all, muscle-specific genes. MEF2A plays diverse roles in the control of cell growth, survival and apoptosis via p38 MAPK signaling in muscle-specific and\/or growth factor-related transcription. MEF2A also has key roles in cardiac and skeletal muscle development. MEF2A is especially abundant in granule neurons of the cerebellar cortex throughout the period of synaptogenesis. This antibody can detect two bands around 60 kDa to 70 kDa, the larger band may correspond to its post-translational modifications.(PMID: 15483225,16484498, 23486945 )\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse, rat\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30349 Product name: Recombinant human MEF2A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 126-258 aa of BC013437 Sequence: MRNHKIAPGLPPQNFSMSVTVPVTSPNALSYTNPGSSLVSPSLAASSTLTDSSMLSPPQTTLHRNVSPGAPQRPPSTGNAGGMLSTTDLTVPNGAGSSPVGNGFVNSRASPNLIGATGANSLGKVMPTKSPPP Predict reactive species\nFull Name: myocyte enhancer factor 2A\nCalculated Molecular Weight: 499 aa, 54 kDa\nObserved Molecular Weight: 50-70kDa\nGenBank Accession Number: BC013437\nGene Symbol: MEF2A\nGene ID (NCBI): 4205\nRRID: AB_3086086\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q02078\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869708734633,"sku":"28819-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-28819-1-ap","provider":"Iright","version":"1.0","type":"link"}