{"product_id":"proteintech-28869-1-ap","title":"Proteintech, 28869-1-AP, SARS-CoV-2 S protein (126-264 aa) Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SARS-CoV-2 S protein (126-264 aa) (28869-1-AP) by Proteintech is a Polyclonal antibody targeting SARS-CoV-2 S protein (126-264 aa) in ELISA applications with reactivity to Virus samples\n28869-1-AP targets SARS-CoV-2 S protein (126-264 aa) in WB, IP, ELISA applications and shows reactivity with Virus samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive ELISA detected in: Recombinant protein\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nEnzyme-linked Immunosorbent Assay (ELISA): ELISA :\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCoronaviruses (CoVs) infect human and animals and cause varieties of diseases, including respiratory, enteric, renal, and neurological diseases. CoV uses its spike protein to recognize ACE2 as its receptors and mediate membrane fusion and virus entry into host cells(PMID: 32221306). Each monomer of trimeric S protein is about 180 kDa, and contains two subunits, S1 and S2,S1 recognizes and binds to host receptors, and subsequent conformational changes in S2 facilitate fusion between the viral envelope and the host cell membrane(PMID: 19198616). Although the amino acid sequences of the S-glycoprotein were found to be different between the various HCoV, the structures showed high similarity, but the best 3D structural overlap shared by SARS-CoV and SARS-CoV-2, consistent with the shared ACE2 predicted receptor (PMID: 32522207). The spike protein of CoVs can be a target for vaccine and therapeutic development (PMID: 19198616). 28869-1-AP is specific for spike protein of SARS-COV-2, that antigen region is 126-264aa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Virus\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30679 Product name: Recombinant virus spike protein protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 126-264 aa of NC_045512 Sequence: VVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAA Predict reactive species\nFull Name: SARS-CoV-2 Spike Protein\nCalculated Molecular Weight: 141 kDa\nGenBank Accession Number: NC_045512\nGene Symbol: SARS-COV-2\nGene ID (NCBI): 43740568\nRRID: AB_2881225\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869593424041,"sku":"28869-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-28869-1-ap","provider":"Iright","version":"1.0","type":"link"}