{"product_id":"proteintech-28886-1-ap","title":"Proteintech, 28886-1-AP, ENPP1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ENPP1 (28886-1-AP) by Proteintech is a Polyclonal antibody targeting ENPP1 in WB, ELISA applications with reactivity to human samples\n28886-1-AP targets ENPP1 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HepG2 cells,  MDA-MB-231 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nENPP1, also known as PC1 or PC-1, is a type II transmembrane glycoprotein that serves as a critical enzymatic gatekeeper at the interface of cellular metabolism, mineral homeostasis, and immune signaling. It plays a crucial role in bone mineralization and soft tissue calcification, through hydrolyzing high-energy phosphate bonds to produce inorganic pyrophosphate (PPi), a potent inhibitor of ectopic mineral deposition (PMID: 37871131, PMID: 30799235, PMID: 40535334). ENPP1 inhibition protects cGAMP and ATP and reduces adenosine levels in the tumor microenvironment, activates antigen-presenting cells and increases T-cell infiltration promoting anticancer immunity (PMID: 40410143).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30355 Product name: Recombinant human ENPP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 788-873 aa of BC059375 Sequence: DTSQTPLHCENLDTLAFILPHRTDNSESCVHGKHDSSWVEELLMLHRARITDVEHITGLSFYQQRKEPVSDILKLKTHLPTFSQED Predict reactive species\nFull Name: ectonucleotide pyrophosphatase\/phosphodiesterase 1\nCalculated Molecular Weight: 105 kDa\nObserved Molecular Weight: 103-130 kDa\nGenBank Accession Number: BC059375\nGene Symbol: ENPP1\nGene ID (NCBI): 5167\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P22413\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887544062121,"sku":"28886-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-28886-1-ap","provider":"Iright","version":"1.0","type":"link"}