{"product_id":"proteintech-29041-1-ap","title":"Proteintech, 29041-1-AP, CES1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CES1 (29041-1-AP) by Proteintech is a Polyclonal antibody targeting CES1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to Human, rat, mouse samples\n29041-1-AP targets CES1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with Human, rat, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: THP-1 cells, rat liver tissue,  hepG2 cells,  Caco-2 cells\nPositive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: C2C12 cells, HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHuman carboxylesterase 1 (hCE1 or CES1) is a serine esterase that hydrolyzes a variety of endogenous and exogenous substrates. CES1 contributes to approximately 90% of hepatic hydrolytic activity in human livers (PMID: 27895113). Variation in CES1 has the ability to affect the metabolism of methylphenidate (PMID: 28087982). CES1 has 567 amino acids and a theoretical molecular mass of 62 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, rat, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30534 Product name: Recombinant human CES1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 505-566 aa of BC012418 Sequence: NGNPNGEGLPHWPEYNQKEGYLQIGANTQAAQKLKDKEVAFWTNLFAKKAVEKPPQTEHIEL Predict reactive species\nFull Name: carboxylesterase 1 (monocyte\/macrophage serine esterase 1)\nCalculated Molecular Weight: 566 aa, 62 kDa\nObserved Molecular Weight: 62 kDa\nGenBank Accession Number: BC012418\nGene Symbol: CES1\nGene ID (NCBI): 1066\nRRID: AB_3086096\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P23141\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886487261353,"sku":"29041-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-29041-1-ap","provider":"Iright","version":"1.0","type":"link"}