{"product_id":"proteintech-29110-1-ap","title":"Proteintech, 29110-1-AP, RAB20 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RAB20 (29110-1-AP) by Proteintech is a Polyclonal antibody targeting RAB20 in WB, IHC, ELISA applications with reactivity to Human samples\n29110-1-AP targets RAB20 in WB, IHC, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, K-562 cells\nPositive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRAB20 is a member of RAS oncogene family, it has no close relationship to any other members of RAB subfamily which consists of small GTP-binding proteins involved in the regulation of intracellullar vesicular transport. Firstly found highly expressed on the apical side of kidney tubuel epithelial cells, RAB20 was speculated to be involved in apical endocytosi and recylcing processes. So far, its function is not well known, however, RAB20 is recently found higher expressed in pancreatic adenocarcinomas than normal pancreas, which is proved by WB and IHC analyses, suggesting its promising role in diagnosis of pancreatic carcinogenesis. Catalog#11616-1-AP is a rabbit polyclonal antibody raised against full-length of human RAB20.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30459 Product name: Recombinant human RAB20 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 115-234 aa of BC026025 Sequence: VDLTEEGALAGQEKEECSPNMDAGDRVSPRAPKQVQLEDAVALYKKILKYKMLDEQDVPAAEQMCFETSAKTGYNVDLLFETLFDLVVPMILQQRAERPSHTVDISSHKPPKRTRSGCCA Predict reactive species\nFull Name: RAB20, member RAS oncogene family\nCalculated Molecular Weight: 26 kDa\nObserved Molecular Weight: 29 kDa\nGenBank Accession Number: BC026025\nGene Symbol: RAB20\nGene ID (NCBI): 55647\nRRID: AB_3086099\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NX57\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887778222249,"sku":"29110-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-29110-1-ap","provider":"Iright","version":"1.0","type":"link"}