{"product_id":"proteintech-29111-1-ap","title":"Proteintech, 29111-1-AP, MMP14 \/ MT1-MMP Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MMP14 \/ MT1-MMP (29111-1-AP) by Proteintech is a Polyclonal antibody targeting MMP14 \/ MT1-MMP in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n29111-1-AP targets MMP14 \/ MT1-MMP in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMMP14, also named as MT1-MMP, is a key matrix metalloproteinase (MMP) family member which plays a crucial role in tumor growth, invasion and metastasis. MT1-MMP is a cell membrane-bound proteinase, and it enhances degradation of collagen IV,  a major component of the basement membrane, by forming a complex with tissue inhibitor of metalloproteinase-2 (TIMP-2) to activate pro-MMP-2. MT1-MMP can influence venous invasion, intrahepatic metastasis , and patient outcome in hepatocellular carcinoma (HCC). MT1-MMP was reported to be present in centromere and could lead to chromosome instability in MDCK cells, indicating that MT1-MMP may have more novel functions in the intracellular compartments. In western blotting, pro-MMP14 (65 kDa) and MMP14 (51 kDa)  bands showed with the truncated MMP14 (45, 42, 35, 20 kDa) forms (PMID:12097451).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30755 Product name: Recombinant human MMP14 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 356-475 aa of BC064803 Sequence: PIGQFWRGLPASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALFWMPNGKTYFFRGNKYYRFNEELRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFT Predict reactive species\nFull Name: matrix metallopeptidase 14 (membrane-inserted)\nCalculated Molecular Weight: 66 kDa\nObserved Molecular Weight: 66-70 kDa\nGenBank Accession Number: BC064803\nGene Symbol: MMP14\nGene ID (NCBI): 4323\nRRID: AB_2918236\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P50281\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868984234153,"sku":"29111-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-29111-1-ap","provider":"Iright","version":"1.0","type":"link"}