{"product_id":"proteintech-29112-1-ap","title":"Proteintech, 29112-1-AP, GTF2H5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GTF2H5 (29112-1-AP) by Proteintech is a Polyclonal antibody targeting GTF2H5 in IHC, ELISA applications with reactivity to human, mouse samples\n29112-1-AP targets GTF2H5 in IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse kidney tissue, human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGTF2H5 (General Transcription Factor IIH Subunit 5) is a protein encoded by the GTF2H5 gene in humans. It is also known by several other names, including TTDA, TFB5, and TFIIH subunit p8. This protein is a critical component of the TFIIH complex, which is involved in both gene transcription and DNA repair.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30758 Product name: Recombinant human GTF2H5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-42 aa of BC060317 Sequence: MVNVLKGVLIECDPAMKQFLLYLDESNALGKKFIIQDIDDTH Predict reactive species\nFull Name: general transcription factor IIH, polypeptide 5\nCalculated Molecular Weight: 8 kDa\nGenBank Accession Number: BC060317\nGene Symbol: GTF2H5\nGene ID (NCBI): 404672\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6ZYL4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887661437097,"sku":"29112-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-29112-1-ap","provider":"Iright","version":"1.0","type":"link"}