{"product_id":"proteintech-29113-1-ap","title":"Proteintech, 29113-1-AP, RABIF Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RABIF (29113-1-AP) by Proteintech is a Polyclonal antibody targeting RABIF in WB, IHC, IF\/ICC, ELISA applications with reactivity to Human, mouse samples\n29113-1-AP targets RABIF in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with Human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HL-60 cells, HeLa cells,  Jurkat cells\nPositive IHC detected in: mouse brain tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRABIF (Rab-interacting factor)\/MSS4 (mammalian suppressor of Sec4) was the first putative guanine nucleotide exchange factors (GEFs) isolated for Rabs, which may act as a chaperone, allowing interacting Rab proteins to be properly activated where and when they are needed in the cell (PMID: 25158853). RABIF is a 17-kDa protein that is expressed in all mammalian tissues and is in complex with nucleotide-free Rab8 GTPase and Rab10 GTPase (PMID: 28894007, 28228250).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30761 Product name: Recombinant human RABIF protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-72 aa of BC018488 Sequence: MEPAEQPSELVSAEGRNRKAVLCQRCGSRVLQPGTALFSRRQLFLPSMRKKPALSDGSNPDGDLLQEHWLVE Predict reactive species\nFull Name: RAB interacting factor\nCalculated Molecular Weight: 123 aa, 14 kDa\nObserved Molecular Weight: 14 kDa\nGenBank Accession Number: BC018488\nGene Symbol: RABIF\nGene ID (NCBI): 5877\nRRID: AB_3669674\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P47224\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887778746537,"sku":"29113-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-29113-1-ap","provider":"Iright","version":"1.0","type":"link"}