{"product_id":"proteintech-29180-1-ap","title":"Proteintech, 29180-1-AP, EPB41L5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe EPB41L5 (29180-1-AP) by Proteintech is a Polyclonal antibody targeting EPB41L5 in WB, ELISA applications with reactivity to human samples\n29180-1-AP targets EPB41L5 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: LNCaP cells, MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nEPB41L5, a member of the NBL4 subgroup of the band 4.1 superfamily, contains a FERM domain and plays an important role in regulating the connection between plasma membrane proteins and the cytoskeleton underneath the plasma membrane (PMID: 30082297). EPB41L5 is a mesenchymal-specific protein induced during EMT (epithelial-mesenchymal transition) that promotes the disruption of cell-cell adhesion kinetics (PMID: 34784520). EPB41L5 exists as four alternatively spliced isoforms encoded by a gene located on human chromosome 2q14.2.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30300 Product name: Recombinant human EPB41L5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 349-445 aa of BC032822 Sequence: GKTEYQTTKTNKARRSTSFERRPSKRYSRRTLQMKACATKPEELSVHNNVSTQSNGSQQAWGMRSALPVSPSISSAPVPVEIENLPQSPGTDQHDRK Predict reactive species\nFull Name: erythrocyte membrane protein band 4.1 like 5\nObserved Molecular Weight: 58 kDa\nGenBank Accession Number: BC032822\nGene Symbol: EPB41L5\nGene ID (NCBI): 57669\nRRID: AB_3669676\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9HCM4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887582990505,"sku":"29180-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-29180-1-ap","provider":"Iright","version":"1.0","type":"link"}