{"product_id":"proteintech-29218-1-ap","title":"Proteintech, 29218-1-AP, ALG9 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ALG9 (29218-1-AP) by Proteintech is a Polyclonal antibody targeting ALG9 in WB, IHC, ELISA applications with reactivity to human samples\n29218-1-AP targets ALG9 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HL-60 cells, Jurkat cells,  THP-1 cells\nPositive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nALG9 encodes an endoplasmic reticulum enzyme that builds N-glycans, the third ER protein-encoding polycystic disease gene after GANAB and DNAJB11. Autosomal recessive loss of ALG9 results in a severe congenital disorder of glycosylation (CDG) with a multiorgan phenotype that includes kidney cysts (PMID: 31395617). Western blot analysis detected ALG9 at an apparent molecular mass of 70 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30489 Product name: Recombinant human ALG9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 500-582 aa of BC009255 Sequence: EFRGQLPKPFAEGPLATRIVPTDMNDQNLEEPSRYIDISKCHYLVDLDTMRETPREPKYSSNKEEWISLAYRPFLDASRSSKL Predict reactive species\nFull Name: asparagine-linked glycosylation 9, alpha-1,2-mannosyltransferase homolog (S. cerevisiae)\nCalculated Molecular Weight: 70 kDa\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: BC009255\nGene Symbol: ALG9\nGene ID (NCBI): 79796\nRRID: AB_3086105\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H6U8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869807169705,"sku":"29218-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-29218-1-ap","provider":"Iright","version":"1.0","type":"link"}