{"product_id":"proteintech-29231-1-ap","title":"Proteintech, 29231-1-AP, nNOS Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe nNOS (29231-1-AP) by Proteintech is a Polyclonal antibody targeting nNOS in WB, IHC, IF-P, IF-Fro, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples\n29231-1-AP targets nNOS in WB, IHC, IF-P, IF-Fro, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse brain tissue\nPositive IF-Fro detected in: rat brain tissue\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\nImmunofluorescence (IF)-FRO: IF-FRO : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nnNOS belongs to the NOS family. nNOS produces nitric oxide (NO) which is a messenger molecule with diverse functions throughout the body. In the brain and peripheral nervous system, NO displays many properties of a neurotransmitter. NO is a reactive free radical which acts as a biologic mediator in several processes, including neurotransmission and antimicrobial and antitumoral activities. NO is synthesized from L-arginine by nitric oxide synthases. nNOS is a nitric oxide synthase which is highly expressed in skeletal muscle. Genetic variations in nNOS gene are associated with susceptibility to infantile hypertrophic pyloric stenosis type 1 (IHPS1).The antibody can recognize isoform 1,2,4 of nNOS.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag28910 Product name: Recombinant human NOS1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 18-262 aa of NM_000620 Sequence: VRLFKRKVGGLGFLVKERVSKPPVIISDLIRGGAAEQSGLIQAGDIILAVNGRPLVDLSYDSALEVLRGIASETHVVLILRGPEGFTTHLETTFTGDGTPKTIRVTQPLGPPTKAVDLSHQPPAGKEQPLAVDGASGPGNGPQHAYDDGQEAGSLPHANGLAPRPPGQDPAKKATRVSLQGRGENNELLKEIEPVLSLLTSGSRGVKGGAPAKAEMKDMGIQVDRDLDGKSHKPLPLGVENDRVF Predict reactive species\nFull Name: nitric oxide synthase 1 (neuronal)\nCalculated Molecular Weight: 161 kDa\nObserved Molecular Weight: 160 kDa\nGenBank Accession Number: NM_000620\nGene Symbol: nNOS\nGene ID (NCBI): 4842\nRRID: AB_2918255\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P29475\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868985348265,"sku":"29231-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-29231-1-ap","provider":"Iright","version":"1.0","type":"link"}