{"product_id":"proteintech-29261-1-ap","title":"Proteintech, 29261-1-AP, MRP2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MRP2 (29261-1-AP) by Proteintech is a Polyclonal antibody targeting MRP2 in WB, IHC, ELISA applications with reactivity to Human samples\n29261-1-AP targets MRP2 in WB, IHC, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: 37°C incubated A549 cells, 37°C incubated HepG2 cells\nPositive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMulti-drug resistance protein 2 (MRP2), also known as ABCC2, is an ATP binding cassette (ABC) transporter responsible for biliary excretion of xenobiotics, endobiotics, and their metabolites. Deficiency in ABCC2 results in the clinical disorder Dubin-Johnson syndrome. MRP2 is found to be expressed in a variety of human cancers, and is associated with resistance of tumor cells to various anticancer drugs including cisplatin. The predicted molecular weight of MRP2 is 174 kDa, while mature MRP2 usually has a slower migration around 190-250 kDa due to the glycosylation. (16434545, 18834541, 23045960)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30944 Product name: Recombinant human ABCC2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1470-1545 aa of BC136419 Sequence: ETDNLIQTTIQNEFAHCTVITIAHRLHTIMDSDKVMVLDNGKIIECGSPEELLQIPGPFYFMAKEAGIENVNSTKF Predict reactive species\nFull Name: ATP-binding cassette, sub-family C (CFTR\/MRP), member 2\nCalculated Molecular Weight: 1545 aa, 174 kDa\nObserved Molecular Weight: 190-250 kDa\nGenBank Accession Number: BC136419\nGene Symbol: ABCC2\nGene ID (NCBI): 1244\nRRID: AB_3086108\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q92887\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869473755305,"sku":"29261-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-29261-1-ap","provider":"Iright","version":"1.0","type":"link"}