{"product_id":"proteintech-29311-1-ap","title":"Proteintech, 29311-1-AP, FOXP4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FOXP4 (29311-1-AP) by Proteintech is a Polyclonal antibody targeting FOXP4 in WB, IHC, ELISA applications with reactivity to Human, Mouse samples\n29311-1-AP targets FOXP4 in WB, IHC, ELISA applications and shows reactivity with Human, Mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Caco-2 cells, PC-3 cells\nPositive IHC detected in: mouse ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFOXP4, also named as FKHLA, belongs to the FOX family. FOXP4 has been implicated in diverse biological processes in tumor initiation and progression. It has been demonstrated that FOXP4 is significantly upregulated in breast cancer, hepatocellular carcinoma and oral squamous cell carcinoma (PMID: 34590150). FOXP4 has 3 isoforms with the molecular mass of 72-73 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag29953 Product name: Recombinant human FOXP4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 560-678 aa of BC052803 Sequence: ISGLSYGALNASYQAALAESSFPLLNSPGMLNPGSASSLLPLSHDDVGAPVEPLPSNGSSSPPRLSPPQYSHQVQVKEEPAEAEEDRQPGPPLGAPNPSASGPPEDRDLEEELPGEELS Predict reactive species\nFull Name: forkhead box P4\nCalculated Molecular Weight: 678 aa, 73 kDa\nObserved Molecular Weight: 73 kDa\nGenBank Accession Number: BC052803\nGene Symbol: FOXP4\nGene ID (NCBI): 116113\nRRID: AB_2918279\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8IVH2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887642988713,"sku":"29311-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-29311-1-ap","provider":"Iright","version":"1.0","type":"link"}