{"product_id":"proteintech-29318-1-ap","title":"Proteintech, 29318-1-AP, S1PR1\/EDG1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe S1PR1\/EDG1 (29318-1-AP) by Proteintech is a Polyclonal antibody targeting S1PR1\/EDG1 in WB, ELISA applications with reactivity to human, mouse samples\n29318-1-AP targets S1PR1\/EDG1 in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SH-SY5Y cells, mouse brain tissue,  mouse lung tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nS1PR1 (sphingosine-1-phosphate receptor 1), also known as S1P1 or EDG1, is one of five G-protein-coupled receptors for sphingosine-1-phosphate (S1P) (PMID: 18787560). S1P1 and its receptors have important regulatory functions in normal physiology and disease processes, particularly involving the immune, central nervous, and cardiovascular systems (PMID: 21339489). S1PR1 is widely expressed in various cell types, including endothelial cells and lymphocytes (PMID: 14737169). S1P-S1PR1 plays a major role in lymphocyte egress and chemotaxis, cell proliferation and survival, and tumor angiogenesis and metastasis (PMID: 21102457).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag28083 Product name: Recombinant human S1PR1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 311-382 aa of BC018650 Sequence: YTLTNKEMRRAFIRIMSCCKCPSGDSAGKFKRPIIAGMEFSRSKSDNSSHPQKDEGDNPETIMSSGNVNSSS Predict reactive species\nFull Name: sphingosine-1-phosphate receptor 1\nCalculated Molecular Weight: 43 kDa\nObserved Molecular Weight: 45-50 kDa\nGenBank Accession Number: BC018650\nGene Symbol: S1PR1\nGene ID (NCBI): 1901\nRRID: AB_2918281\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P21453\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869590900905,"sku":"29318-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-29318-1-ap","provider":"Iright","version":"1.0","type":"link"}