{"product_id":"proteintech-29319-1-ap","title":"Proteintech, 29319-1-AP, NLGN3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NLGN3 (29319-1-AP) by Proteintech is a Polyclonal antibody targeting NLGN3 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n29319-1-AP targets NLGN3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNeuroligin3 (NLGN3) belongs to the neuroligin family, a class of postsynaptic cell adhesion molecules that regulate synapse organization and dendritic outgrowth, and NLGN3 missense variants have previously been associated with autistic spectrum disorder (ASD).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30536 Product name: Recombinant human NLGN3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 38-142 aa of BC051715 Sequence: QAPAPTVNTHFGKLRGARVPLPSEILGPVDQYLGVPYAAPPIGEKRFLPPEPPPYWSGIRNATHFPPVCPQNIHTAVPEVMLPVWFTANLDIVATYIQEPNEDCL Predict reactive species\nFull Name: neuroligin 3\nCalculated Molecular Weight: 94 kDa\nObserved Molecular Weight: 90-110 kDa\nGenBank Accession Number: BC051715\nGene Symbol: NLGN3\nGene ID (NCBI): 54413\nRRID: AB_3086116\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NZ94\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887738409129,"sku":"29319-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-29319-1-ap","provider":"Iright","version":"1.0","type":"link"}