{"product_id":"proteintech-29323-1-ap","title":"Proteintech, 29323-1-AP, STK11\/LKB1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe STK11\/LKB1 (29323-1-AP) by Proteintech is a Polyclonal antibody targeting STK11\/LKB1 in WB, IHC, ELISA applications with reactivity to Human, Mouse samples\n29323-1-AP targets STK11\/LKB1 in WB, IHC, ELISA applications and shows reactivity with Human, Mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, MCF-7 cells,  HEK-293T cells\nPositive IHC detected in: human lung cancer tissue, human breast cancer tissue,  mouse testis tissue,  human lymphoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:300-1:1200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSTK11(serine\/threonine-protein kinase 11) is also named as LKB1, PJS, and belongs to the protein kinase superfamily. It controls the activity of AMP-activated protein kinase (AMPK) family members, thereby playing a role in various processes such as cell metabolism, cell polarity, apoptosis and DNA damage response. The tumour suppressor protein LKB1 is a serine\/threonine kinase that has been causally linked to Peutz-Jeghers syndrome (PJS). Defects in STK11 are a cause of Peutz-Jeghers syndrome (PJS) and defects in STK11 have been associated with testicular germ cell tumor (TGCT) and some sporadic cancers, especially lung cancers. STK11 has 2 isoforms with MW of 49 kDa and 45 kDa, and can be detected as 50-54 kDa after posttranslational modification.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Mouse\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30903 Product name: Recombinant human STK11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 281-428 aa of BC007981 Sequence: PLSDLLKGMLEYEPAKRFSIRQIRQHSWFRKKHPPAEAPVPIPPSPDTKDRWRSMTVVPYLEDLHGADEDEDLFDIEDDIIYTQDFTVPGQVPEEEASHNGQRRGLPKAVCMNGTEAAQLSTKSRAEGRAPNPARKACSASSKIRRLS Predict reactive species\nFull Name: serine\/threonine kinase 11\nCalculated Molecular Weight: 49 kDa\nObserved Molecular Weight: 50-55 kDa\nGenBank Accession Number: BC007981\nGene Symbol: LKB1\nGene ID (NCBI): 6794\nRRID: AB_2923591\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q15831\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869773025449,"sku":"29323-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-29323-1-ap","provider":"Iright","version":"1.0","type":"link"}