{"product_id":"proteintech-29353-1-ap","title":"Proteintech, 29353-1-AP, INPP5E Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe INPP5E (29353-1-AP) by Proteintech is a Polyclonal antibody targeting INPP5E in WB, IF\/ICC, ELISA applications with reactivity to Human, mouse, rat samples\n29353-1-AP targets INPP5E in WB, IF\/ICC, ELISA applications and shows reactivity with Human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, mouse testis tissue,  rat testis tissue\nPositive IF\/ICC detected in: ARPE-19 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nINPP5E(72 kDa inositol polyphosphate 5-phosphatase) converts phosphatidylinositol 3,4,5-trisphosphate (PtdIns 3,4,5-P3) to PtdIns-P2.In mouse, highest protein expression was in brain, heart, and testis, with lower expression in thymus and lung, and very little expression in kidney, spleen, and liver(PMID:10764818). Defects in INPP5E are the cause of Joubert syndrome type 1 (JBTS1) and mental retardation-truncal obesity-retinal dystrophy-micropenis (MORMS)(PMID:19668215). It has 2 isoforms with the molecular mass of 66 kDa and 70 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30305 Product name: Recombinant human INPP5E protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 184-350 aa of BC028032 Sequence: RLPSLLPPRPPPALSLDIASDSLRTANKVDSDLADYKLRAQPLLVRAHSSLGPGRPRSPLACDDCSLRSAKSSFSLLAPIRSKDVRSRSYLEGSLLASGALLGADELARYFPDRNVALFVATWNMQGQKELPPSLDEFLLPAEADYAQDLYVIGVQEGCSDRREWET Predict reactive species\nFull Name: inositol polyphosphate-5-phosphatase, 72 kDa\nCalculated Molecular Weight: 644 aa, 70 kDa\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: BC028032\nGene Symbol: INPP5E\nGene ID (NCBI): 56623\nRRID: AB_3086123\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NRR6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887684636841,"sku":"29353-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-29353-1-ap","provider":"Iright","version":"1.0","type":"link"}