{"product_id":"proteintech-29386-1-ap","title":"Proteintech, 29386-1-AP, AQP2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe AQP2 (29386-1-AP) by Proteintech is a Polyclonal antibody targeting AQP2 in WB, IHC, IF-P, IF-Fro, ELISA applications with reactivity to human, mouse samples\n29386-1-AP targets AQP2 in WB, IHC, IF-P, IF-Fro, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: 37°C incubated mouse kidney tissue\nPositive IHC detected in: mouse kidney tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse kidney tissue\nPositive IF-Fro detected in: mouse kidney tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\nImmunofluorescence (IF)-FRO: IF-FRO : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAQP2 (Aquaporin2) is a water channel protein that is widely distributed among mammalian tissues and plays a major role in water homeostasis. AQP2 is mainly found in the apical cell membranes of the kidney's collecting duct cells and is critical for urinary concentration. AQP2 can be glycosylated and this antibody recognizes the 28-29 kDa non-glycosylated as well as the 35-40 kDa glycosylated forms of AQP2.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag29931 Product name: Recombinant human AQP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 207-271 aa of NM_000486 Sequence: GPLVGAILGSLLYNYVLFPPAKSLSERLAVLKGLEPDTDWEEREVRRRQSVELHSPQSLPRGTKA Predict reactive species\nFull Name: aquaporin 2 (collecting duct)\nCalculated Molecular Weight: 29 kDa\nObserved Molecular Weight: 28-29, 35-38 kDa\nGenBank Accession Number: NM_000486\nGene Symbol: AQP2\nGene ID (NCBI): 359\nRRID: AB_2918288\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P41181\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868992524457,"sku":"29386-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-29386-1-ap","provider":"Iright","version":"1.0","type":"link"}