{"product_id":"proteintech-29392-1-ap","title":"Proteintech, 29392-1-AP, LMO7 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LMO7 (29392-1-AP) by Proteintech is a Polyclonal antibody targeting LMO7 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n29392-1-AP targets LMO7 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HeLa cells,  mouse lung tissue\nPositive IHC detected in: mouse heart tissue, mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLMO7, also known as LOMP, FBX20, belongs to the single Calponin-homology (CH) domain-containing protein family, with a single actin-binding CH domain at the amino terminal end(PMID: 19459066). LMO7 also contains a PDZ domain and a carboxyl-terminal LIM domain, both of which have been described as protein-protein interacting domains(PMID: 15140894).  LMO7 encodes three splice variants of calculated molecular weights of 196 kDa (P200), 157 kDa (P150), and 100 kDa (P100)(PMID: 26157009).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30016 Product name: Recombinant human LMO7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 695-838 aa of NM_005358 Sequence: KIYGENGSKSMSDVSAEDVQNLRQLRYEEMQKIKSQLKEQDQKWQDDLAKWKDRRKSYTSDLQKKKEEREEIEKQALEKSKRSSKTFKEMLQDRESQNQKSTVPSRRRMYSFDDVLEEGKRPPTMTVSEASYQSERVEEKGATY Predict reactive species\nFull Name: LIM domain 7\nCalculated Molecular Weight: 193 kDa\nObserved Molecular Weight: 140-160 kDa\nGenBank Accession Number: NM_005358\nGene Symbol: LMO7\nGene ID (NCBI): 4008\nRRID: AB_3086128\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8WWI1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887705411753,"sku":"29392-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-29392-1-ap","provider":"Iright","version":"1.0","type":"link"}