{"product_id":"proteintech-29413-1-ap","title":"Proteintech, 29413-1-AP, UBQLN4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe UBQLN4 (29413-1-AP) by Proteintech is a Polyclonal antibody targeting UBQLN4 in WB, IHC, ELISA applications with reactivity to Human samples\n29413-1-AP targets UBQLN4 in WB, IHC, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: BGC-823 cells, BxPC-3 cells,  HeLa cells,  MKN-45 cells\nPositive IHC detected in: human cervical cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nUbiquilins (UBQLNs) are important factors for cell proteostasis maintenance.\nUBQLNs are involved in the modulation of the cell cycle, as well as in apoptosis, membrane receptors regulation, DNA repair, epithelial-mesenchymal transition, and miRNA activities. Ubiquilin 4 (UBQLN4) is an important member of the ubiquitin-like protein family. UBQLN4 is overexpressed in aggressive tumors and inhibits homologous recombination, redirecting doublestrand break repair to nonhomologous end joining, resulting in increased genome instability and inducing carcinogenesis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag29658 Product name: Recombinant human UBQLN4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 82-186 aa of BC063841 Sequence: IKTPQKAQDPAAATASSPSTPDPASAPSTTPASPATPAQPSTSGSASSDAGSGSRRSSGGGPSPGAGEGSPSATASILSGFGGILGLGSLGLGSANFMELQQQMQ Predict reactive species\nFull Name: ubiquilin 4\nCalculated Molecular Weight: 601 aa, 64 kDa\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: BC063841\nGene Symbol: UBQLN4\nGene ID (NCBI): 56893\nRRID: AB_3086129\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NRR5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887915651241,"sku":"29413-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-29413-1-ap","provider":"Iright","version":"1.0","type":"link"}