{"product_id":"proteintech-29441-1-ap","title":"Proteintech, 29441-1-AP, YTHDC1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe YTHDC1 (29441-1-AP) by Proteintech is a Polyclonal antibody targeting YTHDC1 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n29441-1-AP targets YTHDC1 in WB, IHC, IF, IP, CoIP, ChIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HepG2 cells,  HSC-T6 cells,  NIH\/3T3 cells,  MDA-MB-231 cells\nPositive IP detected in: HEK-293 cells\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nYTHDC1, containing 1 YTH domain, is one of the m6A-binding proteins that can recognize and bind to the m6A methylation site and plays a specific role in gene expression. YTHDC1 is constitutively enriched in the nucleus. It regulates mRNA splicing by bridging the interactions between the trans- and cis-regulatory elements to bind targeted mRNAs. YTHDC1 mediates the export of m6A modified mRNA from the nucleus to the cytoplasm by interacting with SRSF3, which is an essential factor driving the tumorigenic process in various types of cancers including breast cancer, colon cancer, ovarian cancer, osteosarcoma, and glioblastoma (32368386).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag31459 Product name: Recombinant human YTHDC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-180 aa of BC053863 Sequence: MAADSREEKDGELNVLDDILTEVPEQDDELYNPESEQDKNEKKGSKRKSDRMESTDTKRQKPSVHSRQLVSKPLSSSVSNNKRIVSTKGKSATEYKNEEYQRSERNKRLDADRKIRLSSSASREPYKNQPEKTCVRKRDPERRAKSPTPDGSERIGLEVDRRASRSSQSSKEEVNSEEYG Predict reactive species\nFull Name: YTH domain containing 1\nCalculated Molecular Weight: 85 kDa\nObserved Molecular Weight: ~100 kDa\nGenBank Accession Number: BC053863\nGene Symbol: YTHDC1\nGene ID (NCBI): 91746\nRRID: AB_2918307\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96MU7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868883505321,"sku":"29441-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-29441-1-ap","provider":"Iright","version":"1.0","type":"link"}