{"product_id":"proteintech-29465-1-ap","title":"Proteintech, 29465-1-AP, ERAL1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ERAL1 (29465-1-AP) by Proteintech is a Polyclonal antibody targeting ERAL1 in WB, IHC, ELISA applications with reactivity to Human samples\n29465-1-AP targets ERAL1 in WB, IHC, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293T cells, K-562 cells\nPositive IHC detected in: human colon tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunohistochemistry (IHC): IHC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nERAL1, a homologue of Era protein in Escherichia coli, is a member of conserved GTP-binding proteins with RNA-binding activity. ERAL1 localizes to the mitochondrionmitoribosomal subunit, and binds to the 3' terminal stem loop of 12S mitochondrial rRNA and is required for proper assembly of the 28S small mitochondrial ribosomal subunit. Deletion of ERAL1 has been shown to cause mitochondrial dysfunction, growth retardation, and apoptosis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30720 Product name: Recombinant human ERAL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 235-385 aa of BC019094 Sequence: MNKVDCLKQKSVLLELTAALTEGVVNGKKLKMRQAFHSHPGTHCPSPAVKDPNTQSVGNPQRIGWPHFKEIFMLSALSQEDVKTLKQYLLTQAQPGPWEYHSAVLTSQTPEEICANIIREKLLEHLPQEVPYNVQQKTAVWEEGPGGELVI Predict reactive species\nFull Name: Era G-protein-like 1 (E. coli)\nCalculated Molecular Weight: 437 aa, 48 kDa\nObserved Molecular Weight: 40-45 kDa\nGenBank Accession Number: BC019094\nGene Symbol: ERAL1\nGene ID (NCBI): 26284\nRRID: AB_2918311\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O75616\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887626965161,"sku":"29465-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-29465-1-ap","provider":"Iright","version":"1.0","type":"link"}