{"product_id":"proteintech-29469-1-ap","title":"Proteintech, 29469-1-AP, VGLUT1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe VGLUT1 (29469-1-AP) by Proteintech is a Polyclonal antibody targeting VGLUT1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n29469-1-AP targets VGLUT1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: unboiled mouse brain tissue,  unboiled rat cerebellum tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunohistochemistry (IHC): IHC : 1:300-1:1200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nVesicular glutamate transporter 1 (VGLUT1) is a critical protein involved in the packaging and release of the neurotransmitter glutamate in synaptic vesicles. VGLUT1 is predominantly expressed in neurons that release glutamate, the primary excitatory neurotransmitter in the central nervous system, it is a marker of glutamatergic neurons. VGLUT1 has several isoforms with the moleculat weight range from 53-61 kDa.VGLUT1 is a multiple transmembrane protein, which is easily to aggregate if the sample is bolied or treated with high temperature, thus we recommend to use unboiled sample for the detection.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag31193 Product name: Recombinant human VGLUT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 500-560 aa of NM_020309 Sequence: PEEMSEEKCGFVGHDQLAGSDDSEMEDEAEPPGAPPAPPPSYGATHSTFQPPRPPPPVRDY Predict reactive species\nFull Name: solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 7\nCalculated Molecular Weight: 62 kDa\nObserved Molecular Weight: 55-60 kDa\nGenBank Accession Number: NM_020309\nGene Symbol: VGLUT1\nGene ID (NCBI): 57030\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9P2U7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887919911081,"sku":"29469-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-29469-1-ap","provider":"Iright","version":"1.0","type":"link"}