{"product_id":"proteintech-29474-1-ap","title":"Proteintech, 29474-1-AP, WEE1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe WEE1 (29474-1-AP) by Proteintech is a Polyclonal antibody targeting WEE1 in WB, ELISA applications with reactivity to Human, mouse samples\n29474-1-AP targets WEE1 in WB, IF, CoIP, ELISA applications and shows reactivity with Human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: K-562 cells, nouse brain tissue,  mouse heart tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nWEE1 kinase is a serine-threonine kinase that regulates G2\/M checkpoint transition. WEE1 triggers G2\/M arrest through inhibitory phosphorylation on Tyr15 of CDK1 (Cdc2) and preventing entry into mitosis to allow DNA repair during DNA damage (PMID: 27427153).The predicted native molecular weight for Wee1 based on the intact human Wee1 cDNA sequence is 72 kDa, whereas the 95-110 kDa protein is a highly modified product (PMID: 7568188). Others have shown that Wee1 is 70-72 kDa and 49-55 kDa (PMID: 12214061).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30194 Product name: Recombinant human WEE1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 515-646 aa of BC051831 Sequence: PLPRNGDQWHEIRQGRLPRIPQVLSQEFTELLKVMIHPDPERRPSAMALVKHSVLLSASRKSAEQLRIELNAEKFKNSLLQKELKKAQMAKAAAEERALFTDRMATRSTTQSNRTSRLIGKKMNRSVSLTIY Predict reactive species\nFull Name: WEE1 homolog (S. pombe)\nCalculated Molecular Weight: 72 kDa\nObserved Molecular Weight: 72 kDa,110 kDa\nGenBank Accession Number: BC051831\nGene Symbol: WEE1\nGene ID (NCBI): 7465\nRRID: AB_2918314\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P30291\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868975616169,"sku":"29474-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-29474-1-ap","provider":"Iright","version":"1.0","type":"link"}