{"product_id":"proteintech-29480-1-ap","title":"Proteintech, 29480-1-AP, PLOD1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PLOD1 (29480-1-AP) by Proteintech is a Polyclonal antibody targeting PLOD1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to Human samples\n29480-1-AP targets PLOD1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A375 cells, K-562 cells,  HeLa cells,  U-251 cells,  U2OS cells\nPositive IHC detected in: human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: K-562 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPLOD1, as known as procollagen‐lysine, 2‐oxoglutarate 5‐dioxygenase 1, is a member of the PLOD family(Uniprot, GeneID:5351). PLOD1 participates in catalyzing hydroxylysine residue, which is critical for the formation of covalent cross-link (PMID:30003082). PLOD1 plays an important role in the development and progression of tumors. Aberrantly expressed PLOD1 promotes cancer aggressiveness in glioma and bladder cancer, providing a potential prognostic biomarker and therapeutic target (PMID:31199049, PMID:34040895). PLOD1 has 2 isoforms produced by alternative splicing.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag31626 Product name: Recombinant human PLOD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 450-564 aa of BC016657 Sequence: YISNIYLIKGSALRGELQSSDLFHHSKLDPDMAFCANIRQQDVFMFLTNRHTLGHLLSLDSYRTTHLHNDLWEVFSNPEDWKEKYIHQNYTKALAGKLVETPCPDVYWFPIFTEV Predict reactive species\nFull Name: procollagen-lysine 1, 2-oxoglutarate 5-dioxygenase 1\nCalculated Molecular Weight: 727 aa, 84 kDa\nObserved Molecular Weight: 84-88 kDa\nGenBank Accession Number: BC016657\nGene Symbol: PLOD1\nGene ID (NCBI): 5351\nRRID: AB_2918315\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q02809\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869488173225,"sku":"29480-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-29480-1-ap","provider":"Iright","version":"1.0","type":"link"}