{"product_id":"proteintech-29489-1-ap","title":"Proteintech, 29489-1-AP, PKMYT1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PKMYT1 (29489-1-AP) by Proteintech is a Polyclonal antibody targeting PKMYT1 in WB, ELISA applications with reactivity to Human samples\n29489-1-AP targets PKMYT1 in WB, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells, T-47D cells,  A549 cells,  MKN-45 cells,  NCI-H1299 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPKMYT1, also known as MYT1, belongs to the WEE1 family. PKMYT1 functions to negatively regulate the Cdc2-cyclin B complexes by phosphorylating Cdc2 on threonine 14 and tyrosine 15. PKMYT1 has also been implicated in an increasing number of cancer types, including gastric cancer, non-small-cell lung cancer, hepatocellular carcinoma, glioblastoma, neuroblastoma, and colorectal cancer, in which overexpression of PKMYT1 generally correlates with poor prognosis and disease progression. PKMYT1 also has another key role in the cell cycle - regulating Golgi membrane reassembly following mitosis - and depletion of PKMYT1 leads to cell death. PKMYT1 was strongly phosphorylated during mitosis. This antibody can recognize interphase and mitotic phase PKMYT1. (PMID: 9268380, 32127662)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30573 Product name: Recombinant human PKMYT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-180 aa of NM_004203 Sequence: MLERPPALAMPMPTEGTPPPLSGTPIPVPAYFRHAEPGFSLKRPRGLSRSLPPPPPAKGSIPISRLFPPRTPGWHQLQPRRVSFRGEASETLQSPGYDPSRPESFFQQSFQRLSRLGHGSYGEVFKVRSKEDGRLYAVKRSMSPFRGPKDRARKLAEVGSHEKVGQHPCCVRLEQAWEEG Predict reactive species\nFull Name: protein kinase, membrane associated tyrosine\/threonine 1\nCalculated Molecular Weight: 55 kDa\nObserved Molecular Weight: 60-75 kDa\nGenBank Accession Number: NM_004203\nGene Symbol: PKMYT1\nGene ID (NCBI): 9088\nRRID: AB_3086137\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q99640\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887763509417,"sku":"29489-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-29489-1-ap","provider":"Iright","version":"1.0","type":"link"}