{"product_id":"proteintech-29491-1-ap","title":"Proteintech, 29491-1-AP, Progranulin\/PGRN Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Progranulin\/PGRN (29491-1-AP) by Proteintech is a Polyclonal antibody targeting Progranulin\/PGRN in WB, ELISA applications with reactivity to human, mouse samples\n29491-1-AP targets Progranulin\/PGRN in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, 4T1 cells,  HEK-293 cells,  HepG2 cells,  MCF-7 cells,  U-937 cells,  J774A.1 cells,  NIH\/3T3 cells,  RAW 264.7 cells,  mouse lung tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGRN, also known as PGRN or PCDGF, is a cysteine-rich protein of 68.5 kDa that is typically secreted into a highly glycosylated 88 kDa form. PGRN is a unique growth factor that plays an important role in cutaneous wound healing. It has an anti-inflammatory effect and promotes cell proliferation. When PCDGF is degraded to several 6-25 kDa fragments, called granulins (GRNs) by neutrophil proteases, a pro-inflammatory reaction occurs. PGRN is widely expressed, particularly in epithelial cells, immune cells, neurons, and chondrocytes. High levels of PGRN expression have been reported in human cancers, and its expression is closely correlated with the development and metastasis of several cancers. The recent discovery that mutations in the gene encoding for pro-granulin (GRN) cause frontotemporal lobar degeneration (FTLD), and other neurodegenerative diseases leading to dementia, has brought renewed interest in progranulin and its functions in the central nervous system.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30723 Product name: Recombinant human PCDGF,GRN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 18-162 aa of BC000324 Sequence: TRCPDGQFCPVACCLDPGGASYSCCRPLLDKWPTTLSRHLGGPCQVDAHCSAGHSCIFTVSGTSSCCPFPEAVACGDGHHCCPRGFHCSADGRSCFQRSGNNSVGAIQCPDSQFECPDFSTCCVMVDGSWGCCPMPQASCCEDRV Predict reactive species\nFull Name: granulin\nCalculated Molecular Weight: 64 kDa\nObserved Molecular Weight: 70-75 kDa\nGenBank Accession Number: BC000324\nGene Symbol: Granulin\nGene ID (NCBI): 2896\nRRID: AB_3086138\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P28799\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869743501481,"sku":"29491-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-29491-1-ap","provider":"Iright","version":"1.0","type":"link"}