{"product_id":"proteintech-29508-1-ap","title":"Proteintech, 29508-1-AP, Annexin A4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Annexin A4 (29508-1-AP) by Proteintech is a Polyclonal antibody targeting Annexin A4 in WB, ELISA applications with reactivity to Human, rat, mouse samples\n29508-1-AP targets Annexin A4 in WB, ELISA applications and shows reactivity with Human, rat, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells,  mouse kidney tissue,  mouse liver tissue,  mouse lung tissue,  rat kidney tissue,  NIH\/3T3 cells,  RAW 264.7 cells,  HuH-7 cells,  PC-12 cells,  C6 cells,  human placenta tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAnnexin A4 (Anxa4) is one of the Ca2 +-regulated and phospholipid-binding annexin superfamily proteins, and is located at 2p13. Anxa4 has a potential role in diagnosis, prognosis, and treatment of certain cancers. Annexin A4 shares 45 to 59% identity with other members and possibly interacts with ATP. Annexin A4 has in vitro anticoagulant activity and also inhibits phospholipase A2 activity. The Annexin A4 protein is expressed in a wide range of tissues, associated with polarized epithelial cells and is proposed to be involved in the regulation of chloride ions across the epithelial membrane.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, rat, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30827 Product name: Recombinant human Annexin IV protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 118-274 aa of BC000182 Sequence: RTPEEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVLVSLSAGGRDEGNYLDDALVRQDAQDLYEAGEKKWGTDEVKFLTVLCSRNRNHLLHVFDEYKRISQKDIEQSIKSETSGSFEDALLAIVKCMRNKSAYFAEKLYKSMKGLGTDDNTLIRVM Predict reactive species\nFull Name: annexin A4\nCalculated Molecular Weight: 36 kDa\nObserved Molecular Weight: 36 kDa\nGenBank Accession Number: BC000182\nGene Symbol: Annexin A4\nGene ID (NCBI): 307\nRRID: AB_2918319\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P09525\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46884970823849,"sku":"29508-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-29508-1-ap","provider":"Iright","version":"1.0","type":"link"}