{"product_id":"proteintech-29519-1-ap","title":"Proteintech, 29519-1-AP, KGA\/GAC Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe KGA\/GAC (29519-1-AP) by Proteintech is a Polyclonal antibody targeting KGA\/GAC in WB, IF\/ICC, ELISA applications with reactivity to human samples\n29519-1-AP targets KGA\/GAC in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: COLO 320 cells, A549 cells,  Hela cells,  MCF-7 cells,  SH-SY5Y cells\nPositive IF\/ICC detected in: L02 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGLS, also named as GLS1 and KIAA0838, belongs to the glutaminase family. It catalyzes the first reaction in the primary pathway for the renal catabolism of glutamine. Glutaminase-, glutamate-, and taurine-immunoreactive neurons develop neurofibrillary tangles in Alzheimer's disease(PMID:1672808).The glutaminase band in AA\/C1 cells is more intense than in HT29 cells, in accordance with measurements of glutaminase activity, and had the same molecular mass of approx. 63 kDa. The bands for both cell lines are clearly different in size from both rat liver glutaminase (58 kDa) and rat kidney glutaminase (65 kDa)(PMID:12408749). It also reveals a molecular weight of 83-84 kDa as a phosphate-dependent glutaminase(PMID:447624;7512428). It has 3 isoforms named as KGA, GAM, GAC. This antibody can recognize KGA and GAC.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag31167 Product name: Recombinant human GLS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-140 aa of NM_014905 Sequence: MMRLRGSGMLRDLLLRSPAGVSATLRRAQPLVTLCRRPRGGGRPAAGPAAAARLHPWWGGGGWPAEPLARGLSSSPSEILQELGKGSTHPQPGVSPPAAPAAPGPKDGPGETDAFGNSEGKELVASGENKIKQGLLPSLE Predict reactive species\nFull Name: glutaminase\nCalculated Molecular Weight: 73 kDa\nObserved Molecular Weight: 58 kDa, 65 kDa\nGenBank Accession Number: NM_014905\nGene Symbol: GLS\nGene ID (NCBI): 2744\nRRID: AB_2918320\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O94925\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868906672297,"sku":"29519-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-29519-1-ap","provider":"Iright","version":"1.0","type":"link"}