{"product_id":"proteintech-29552-1-ap","title":"Proteintech, 29552-1-AP, BAK Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe BAK (29552-1-AP) by Proteintech is a Polyclonal antibody targeting BAK in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n29552-1-AP targets BAK in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, Neuro-2a cells,  HEK-293 cells,  HepG2 cells,  Jurkat cells,  MOLT-4 cells,  4T1 cells,  ROS1728 cells\nPositive IP detected in: A431 cells\nPositive IHC detected in: human colon cancer tissue, rat heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form oligomers or heterodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein localizes to mitochondria, and functions to induce apoptosis. It interacts with and accelerates the opening of the mitochondrial voltage-dependent anion channel, which leads to a loss in membrane potential and the release of cytochrome c. This protein also interacts with the tumor suppressor P53 after exposure to cell stress.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, chicken\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag31042 Product name: Recombinant human BAK protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-100 aa of NM_001188 Sequence: MASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHL Predict reactive species\nFull Name: BCL2-antagonist\/killer 1\nCalculated Molecular Weight: 23 kDa\nObserved Molecular Weight: 23-25 kDa\nGenBank Accession Number: NM_001188\nGene Symbol: BAK1\nGene ID (NCBI): 578\nRRID: AB_2923596\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q16611\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868863877289,"sku":"29552-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-29552-1-ap","provider":"Iright","version":"1.0","type":"link"}