{"product_id":"proteintech-29594-1-ap","title":"Proteintech, 29594-1-AP, NUMB Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NUMB (29594-1-AP) by Proteintech is a Polyclonal antibody targeting NUMB in WB, IF\/ICC, ELISA applications with reactivity to Human, Mouse, Rat samples\n29594-1-AP targets NUMB in WB, IF\/ICC, ELISA applications and shows reactivity with Human, Mouse, Rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, HeLa cells,  NIH\/3T3 cells,  mouse brain tissue,  rat brain tissue\nPositive IF\/ICC detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNUMB plays a role in the process of neurogenesis. It is required throughout embryonic neurogenesis to maintain neural progenitor cells, also called radial glial cells (RGCs), by allowing their daughter cells to choose progenitor over neuronal cell fate. NUMB may also mediate local repair of brain ventricular wall damage. NUMB may play a role infurther understanding the NUMB function in development and cancer.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Mouse, Rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag31553 Product name: Recombinant human NUMB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 510-651 aa of NM_001005743 Sequence: SYPVANGMPYPAPNVPVVGITPSQMVANVFGTAGHPQAAHPHQSPSLVRQQTFPHYEASSATTSPFFKPPAQHLNGSAAFNGVDDGRLASADRHTEVPTGTCPVDPFEAQWAALENKSKQRTNPSPTNPFSSDLQKTFEIEL Predict reactive species\nFull Name: numb homolog (Drosophila)\nCalculated Molecular Weight: 71KD\nObserved Molecular Weight: 66-72 kDa\nGenBank Accession Number: NM_001005743\nGene Symbol: NUMB\nGene ID (NCBI): 8650\nRRID: AB_2923598\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P49757\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887744405673,"sku":"29594-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-29594-1-ap","provider":"Iright","version":"1.0","type":"link"}