{"product_id":"proteintech-29599-1-ap","title":"Proteintech, 29599-1-AP, TMEM66 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TMEM66 (29599-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM66 in IHC, ELISA applications with reactivity to human, mouse samples\n29599-1-AP targets TMEM66 in IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse pancreas tissue, mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTMEM66\/SOCE-associated regulatory factor (SARAF) is an endoplasmic reticulum (ER)-resident transmembrane protein that promotes SOCE inactivation and prevents Ca2+ overfilling of the cell. TMEM66 plays a key role in shaping cytosolic Ca2+ signals and determining the content of the major intracellular Ca2+ stores, which is probably important in protecting the cell from Ca2+ overfilling (PMID: 37007714). TMEM66 is a highly conserved protein in vertebrates. In mammals, TMEM66 is ubiquitously expressed, but has significantly high transcript levels in the immune and neuronal tissues (PMID: 25469256). Moreover, TMEM66 is an androgen-responsive marker for prostate cancer and mTOR-dependent cardiac growth (PMID:32173353).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag29388 Product name: Recombinant human TMEM66 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 32-183 aa of BC015012 Sequence: NDPDRMLLRDVKALTLHYDRYTTSRRLDPIPQLKCVGGTAGCDSYTPKVIQCQNKGWDGYDVQWECKTDLDIAYKFGKTVVSCEGYESSEDQYVLRGSCGLEYNLDYTELGLQKLKESGKQHGFASFSDYYYKWSSADSCNMSGLITIVVLL Predict reactive species\nFull Name: transmembrane protein 66\nCalculated Molecular Weight: 339 aa, 37 kDa\nGenBank Accession Number: BC015012\nGene Symbol: TMEM66\nGene ID (NCBI): 51669\nRRID: AB_3086144\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96BY9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887833370793,"sku":"29599-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-29599-1-ap","provider":"Iright","version":"1.0","type":"link"}