{"product_id":"proteintech-29621-1-ap","title":"Proteintech, 29621-1-AP, NDUFA9 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NDUFA9 (29621-1-AP) by Proteintech is a Polyclonal antibody targeting NDUFA9 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n29621-1-AP targets NDUFA9 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, U2OS cells,  mouse heart tissue,  mouse skeletal muscle tissue,  rat skeletal muscle tissue\nPositive IHC detected in: human hepatocirrhosis tissue, rat kidney tissue,  rat stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNDUFA9 (NADH: ubiquinone oxidoreductase subunit A9), also named as NDUFS2L, belongs to the complex I NDUFA9 subunit family. NDUFA9 gene encodes a subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (complex I). Instead of being implicated in the catalysis, NDUFA9 is required for proper assembly of the complex I (PMID: 34938809). The predicted molecular weight of NDUFA9 is 42 kDa. With modification, the MW of NDUFA9 will be migrated to 35 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag31222 Product name: Recombinant human NDUFA9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 108-227 aa of BC009311 Sequence: WDARDKDSIRRVVQHSNVVINLIGRDWETKNFDFEDVFVKIPQAIAQLSKEAGVEKFIHVSHLNANIKSSSRYLRNKAVGEKVVRDAFPEAIIVKPSDIFGREDRFLNSFASMHRFGPIP Predict reactive species\nFull Name: NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa\nCalculated Molecular Weight: 377 aa, 43 kDa\nObserved Molecular Weight: 35 kDa\nGenBank Accession Number: BC009311\nGene Symbol: NDUFA9\nGene ID (NCBI): 4704\nRRID: AB_2918331\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q16795\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887734149289,"sku":"29621-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-29621-1-ap","provider":"Iright","version":"1.0","type":"link"}