{"product_id":"proteintech-29752-1-ap","title":"Proteintech, 29752-1-AP, SHH Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SHH (29752-1-AP) by Proteintech is a Polyclonal antibody targeting SHH in WB, IHC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples\n29752-1-AP targets SHH in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells,  MCF-7 cells,  MDA-MB-231 cells,  mouse liver tissue,  rat liver tissue\nPositive IHC detected in: mouse embryo tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSHH, Sonic hedgehog protein, binds to the patched (PTCH1) receptor, which functions in association with smoothened (SMO), to activate the transcription of target genes (PMID: 10753901). In the absence of SHH, PTCH1 represses the constitutive signaling activity of SMO (PMID: 10753901). SHH is synthesized as a 45 kDa precursor that undergoes an autocatalytic processing event that produces a 19 kDa N-terminal product, responsible for all signaling activities, and a 25 kDa C-terminal fragment (PMID: 10753901, PMID: 16282375).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag31338 Product name: Recombinant human SHH protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 23-123 aa of NM_000193 Sequence: CGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKISRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRV Predict reactive species\nFull Name: sonic hedgehog homolog (Drosophila)\nCalculated Molecular Weight: 50 kDa\nObserved Molecular Weight: 50-60 kDa\nGenBank Accession Number: NM_000193\nGene Symbol: SHH\nGene ID (NCBI): 6469\nRRID: AB_2935475\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q15465\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887800897705,"sku":"29752-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-29752-1-ap","provider":"Iright","version":"1.0","type":"link"}