{"product_id":"proteintech-29755-1-ap","title":"Proteintech, 29755-1-AP, EPX Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe EPX (29755-1-AP) by Proteintech is a Polyclonal antibody targeting EPX in WB, IHC, ELISA applications with reactivity to human, mouse, pig samples\n29755-1-AP targets EPX in WB, IHC, ELISA applications and shows reactivity with human, mouse, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: pig bone marrow tissue\nPositive IHC detected in: human hepatocirrhosis tissue, human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30561 Product name: Recombinant human EPX protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 580-673 aa of NM_000502 Sequence: LSQPRNLAQLSRVLKNQDLARKFLNLYGTPDNIDIWIGAIAEPLLPGARVGPLLACLFENQFRRARDGDRFWWQKRGVFTKRQRKALSRISLSR Predict reactive species\nFull Name: eosinophil peroxidase\nCalculated Molecular Weight: 81 kDa\nObserved Molecular Weight: 55 kDa\nGenBank Accession Number: NM_000502\nGene Symbol: EPX\nGene ID (NCBI): 8288\nRRID: AB_3086154\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P11678\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887626866857,"sku":"29755-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-29755-1-ap","provider":"Iright","version":"1.0","type":"link"}