{"product_id":"proteintech-29758-1-ap","title":"Proteintech, 29758-1-AP, DYNC2H1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DYNC2H1 (29758-1-AP) by Proteintech is a Polyclonal antibody targeting DYNC2H1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n29758-1-AP targets DYNC2H1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue\nPositive IHC detected in: mouse kidney tissue, mouse small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: hTERT-RPE1 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDYNC2H1 (Cytoplasmic dynein 2 heavy chain 1) is involved in ciliary intraflagellar transport (IFT). DYNC2H1 drives retrograde transport of the IFT-A protein complex that regulates tip-to-base transport in cilia, involved in the generation and maintenance of cilia. DYNC2H1 variants or retina-predominant variants cause nonsyndromic retinal degeneration (PMID:32753734). DYNC2H1 mutations also cause asphyxiating thoracic dystrophy and short rib-polydactyly syndrome (PMID: 19442771). DYNC2H1 was localized to the basal bodies by immunofluorescence staining (PMID: 21552265, PMID: 26077881, PMID: 30320547).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30707 Product name: Recombinant human DYNC2H1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 42-196 aa of NM_001377 Sequence: FLDDGNQMLLRVQRSDAGISFSNTIEFGDTKDKVLVFFKLRPEVITDENLHDNILVSSMLESPISSLYQAVRQVFAPMLLKDQEWSRNFDPKLQNLLSELEAGLGIVLRRSDTNLTKLKFKEDDTRGILTPSDEFQFWIEQAHRGNKQISKERAN Predict reactive species\nFull Name: dynein, cytoplasmic 2, heavy chain 1\nCalculated Molecular Weight: 493 kDa\nObserved Molecular Weight: 493 kDa\nGenBank Accession Number: NM_001377\nGene Symbol: DYNC2H1\nGene ID (NCBI): 79659\nRRID: AB_2935476\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8NCM8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887375798441,"sku":"29758-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-29758-1-ap","provider":"Iright","version":"1.0","type":"link"}