{"product_id":"proteintech-29767-1-ap","title":"Proteintech, 29767-1-AP, Claudin 5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Claudin 5 (29767-1-AP) by Proteintech is a Polyclonal antibody targeting Claudin 5 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n29767-1-AP targets Claudin 5 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: unboiled mouse lung tissue, unboiled rat lung tissue\nPositive IHC detected in: human colon tissue, mouse lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse lung tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nClaudins are a family of proteins that are the most important components of the tight junctions, where they establish the paracellular barrier that controls the flow of molecules in the intercellular space between the cells of an epithelium. 27 claudins have been identified. They are small (20-27 kilodalton (kDa))  proteins with very similar structure. They have four transmembrane domains, with the N-terminus and the C-terminus in the cytoplasm.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag29044 Product name: Recombinant human CLDN5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 144-218 aa of BC032363 Sequence: VREFYDPSVPVSQKYELGAALYIGWAATALLMVGGCLLCCGAWVCTGRPDLSFPVKYSAPRRPTATGDYDKKNYV Predict reactive species\nFull Name: claudin 5\nCalculated Molecular Weight: 218 aa, 23 kDa\nObserved Molecular Weight: 22 kDa\nGenBank Accession Number: BC032363\nGene Symbol: CLDN5\nGene ID (NCBI): 7122\nRRID: AB_2935477\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O00501\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868851982505,"sku":"29767-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-29767-1-ap","provider":"Iright","version":"1.0","type":"link"}