{"product_id":"proteintech-29775-1-ap","title":"Proteintech, 29775-1-AP, Integrin beta-8 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Integrin beta-8 (29775-1-AP) by Proteintech is a Polyclonal antibody targeting Integrin beta-8 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n29775-1-AP targets Integrin beta-8 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\nPositive IHC detected in: human ovary cancer tissue, human intrahepatic cholangiocarcinoma tissue,  mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIntegrins are cell adhesion receptors that are heterodimers composed of non-covalently associated alpha and beta subunits. Integrin beta-8 (ITGB8), belongs to the integrin beta chain family, contains an N-terminal signal peptide, a large extracellular domain that includes four cysteine-rich repeats, a transmembrane domain, and a C-terminal cytoplasmic domain (PMID: 1918072). Integrin beta-8 associates with integrin alpha-V (ITGAV) to form an αvβ8 heterodimer which has been shown to bind vitronectin, fibronectin, and a latency-associated peptide of TGF-β1\/3 (PMID: 27033701). Integrin beta-8 contains multiple potential N-linked glycosylation sites. The observed molecular mass of approximately 95 kDa for integrin beta-8 is larger than the predicted 86 kDa, consistent with substantial glycosylation (PMID: 1918072).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag31137 Product name: Recombinant human Integrin beta-8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 460-620 aa of NM_002214 Sequence: KIHIHRNCSCQCEDNRGPKGKCVDETFLDSKCFQCDENKCHFDEDQFSSESCKSHKDQPVCSGRGVCVCGKCSCHKIKLGKVYGKYCEKDDFSCPYHHGNLCAGHGECEAGRCQCFSGWEGDRCQCPSAAAQHCVNSKGQVCSGRGTCVCGRCECTDPRSI Predict reactive species\nFull Name: integrin, beta 8\nCalculated Molecular Weight: 86 kDa\nObserved Molecular Weight: 95 kDa\nGenBank Accession Number: NM_002214\nGene Symbol: Integrin beta 8\nGene ID (NCBI): 3696\nRRID: AB_2935479\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P26012\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869467365545,"sku":"29775-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-29775-1-ap","provider":"Iright","version":"1.0","type":"link"}