{"product_id":"proteintech-29782-1-ap","title":"Proteintech, 29782-1-AP, KANK1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe KANK1 (29782-1-AP) by Proteintech is a Polyclonal antibody targeting KANK1 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse samples\n29782-1-AP targets KANK1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293T cells\nPositive IHC detected in: mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse kidney tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nKANK1 (KN motif and ankyrin repeat domain-containing protein 1) is involved in the control of cytoskeleton formation by regulating actin polymerization, inhibiting actin fiber formation and cell migration (PMID: 25961457). It inhibits RhoA activity, the formation of lamellipodia but not of filopodia (PMID: 25961457, PMID: 5961457).It also inhibits fibronectin-mediated cell spreading and regulates Rac signaling pathways (PMID: 25961457). Talin-KANK1 interaction controls the recruitment of cortical microtubule stabilizing complexes to focal adhesions (PMID: 27410476). KANK1 can be detected 130-200 kDa (PMID: 15823577, PMID: 33253712, PMID: 35805114).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag31422 Product name: Recombinant human KANK1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 291-467 aa of NM_015158 Sequence: ISVLQEEKRQLVSQLKNQRAASQINVCGVRKRSYSAGNASQLEQLSRARRSGGELYIDYEEEEMETVEQSTQRIKEFRQLTADMQALEQKIQDSSCEASSELRENGECRSVAVGAEENMNDIVVYHRGSRSCKDAAVGTLVEMRNCGVSVTEAMLGVMTEADKEIELQQQTIESLKE Predict reactive species\nFull Name: KN motif and ankyrin repeat domains 1\nCalculated Molecular Weight: 147KD\nObserved Molecular Weight: 130-200 kDa\nGenBank Accession Number: NM_015158\nGene Symbol: KANK1\nGene ID (NCBI): 23189\nRRID: AB_3086160\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q14678\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887689781417,"sku":"29782-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-29782-1-ap","provider":"Iright","version":"1.0","type":"link"}